TLR9 anticorps (N-Term)

N° du produit ABIN634525

Cet anticorps Lapin Polyclonal détecte spécifiquement TLR9 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour TLR9 anticorps (N-Term) (ABIN634525)

Antigène: TLR9 (Toll-Like Receptor 9 (TLR9))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TLR9 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TLR9 anticorps

Épitope: N-Term

Specificité: TLR9 antibody was raised against the N terminal of TLR9

Purification: Affinity purified

Immunogène: TLR9 antibody was raised using the N terminal of TLR9 corresponding to a region with amino acids VGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TLR9 Blocking Peptide, (ABIN5616641), is also available for use as a blocking control in assays to test for specificity of this TLR9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TLR9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TLR9

Antigène: TLR9 (Toll-Like Receptor 9 (TLR9))

Autre désignation: TLR9

Sujet: TLR9 participates in the innate immune response to microbial agents. TLR9 detects the unmethylated cytidine-phosphate-guanosine (CpG) motifs present in bacterial DNA. TLR9 acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.

Poids moléculaire: 113 kDa (MW of target protein)

Pathways: Signalisation TLR, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Toll-Like Receptors Cascades